Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-captcha domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6114

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-signatures domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6114

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-getresponse domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6114

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-surveys-polls domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6114
Vaksin - WEBSITE PUTIH

Tag: Vaksin

Penggerakan GERMAS Digital – Direktorat Promosi Kesehatan dan Pemberdayaan Masyarakat

KONTAKFAQRSSSITEMAPKIEAKPMPSDPKTUKoordinasi Implementasi Gerakan Masyarakat Hidup Sehat (GERMAS) Daerah telah dilaksanakan pada tanggal 8-10 Desember 2021…

Read More

Bupati Pesisir Barat Dr. Drs. Agus Istiqlal, SH, MH Pimpin Apel Kendaraan Ambulance Pekon Kabupaten Pesisir Barat Tahun 2022 – Kabupaten Pesisir Barat

Bupati Pesisir Barat Dr. Drs. Agus Istiqlal, S.H., M.H Pimpin Apel Kendaraan Ambulance Pekon Kabupaten…

Read More

Enam provinsi capai angka stunting lebih 30 persen pada 2022 – ANTARA

23 Mei 2022 19:0023 Mei 2022 18:5023 Mei 2022 18:2623 Mei 2022 18:251 menit lalu6…

Read More

Bappeda Barsel Singkronkan Program Usulan Melalui Dana DAK 2023 – Prokalteng

BUNTOK, PROKALTENG.CO – Pemerintah Kabupaten Barito Selatan (Barsel) melaksanakan rapat koordinasi guna menyinkronkan program yang…

Read More

Kasus Covid-19 Kembali Meningkat, Diskominfo Tanjungpinang Gencarkan Informasi Prokes BERITA LAINNYA – Pemko Tanjungpinang

Kota Tanjungpinang - Berbagai upaya terus dilakukan Satuan Tugas (satgas) Covid-19 Kota Tanjungpinang dalam mengantisipasi…

Read More

Wali Kota Parepare Ikuti Peringatan Hari Otoda 2022 – Rakyatku.Com

Wali Kota Parepare, Taufan Pawe, mengatakan peringatan Hari Otoda ini menjadi momentum dalam menunjukkan peran…

Read More

Dua Minggu Lagi Kasus Covid-19 RI Bakal Mulai Turun! Amin… – CNBC Indonesia

Jakarta, CNBC Indonesia - Pandemi virus corona (Coronavirus Disease-2019/Covid-19) belu berakhir. Bahkan dengan kehadiran varian…

Read More

Vaksin Covid-19 untuk Anak, Indikator: Masyarakat Terbelah – Bisnis.com

Bisnis.com, JAKARTA – Vaksin Covid-19 yang menyasar anak-anak tidak sepenuhnya didukung oleh orang tua.Lembaga survei…

Read More

Liga Askot PSSI Tanjungpinang Resmi Dimulai, 11 Klub Sepak Bola Usia 21 Akan Bertarung – Pemko Tanjungpinang

Diskominfo, Kota Tanjungpinang - Kompetisi sepak bola usia 21 yang digelar oleh Asosiasi Kota (Askot) Persatuan…

Read More