Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpf-drop-uploader domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6131

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-captcha domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6131

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-signatures domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6131

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-lite domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6131

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-getresponse domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6131

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the wpforms-surveys-polls domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /home/dinkespare.my.id/public_html/wp-includes/functions.php on line 6131
Opini - WEBSITE PUTIH

Kategori: Opini

admin 0 comments

Ramadan 2022, Sri Mulyani Ajak Umat Islam Tetap Taati Protokol Kesehatan – Bisnis Tempo.co

atau cari berdasarkan hariMenteri Keuangan RI Sri Mulyani Indrawati, memberikan apresiasi kinerja BRI dalam mengangkat…

admin 0 comments

Rebutan Urus DAK Lampung Tengah, Aliza Gunado dan Edi Sujarwo Saling Klaim Orang Kepercayaan Azis – Tribunnews.com

TRIBUNNEWS.COM, JAKARTA - Pengadilan Tindak Pidana Korupsi (Tipikor) Jakarta kembali menggelar sidang kasus dugaan suap penghentian…

admin 0 comments

Hari Ini (1/4) Sidang Isbat Penetapan 1 Ramadan 2022, Ini Panduan Ibadah Puasa MUI – Internasional Kontan

Sumber: Kemenag,Kompas.com | Editor: Adi WikantoKONTAN.CO.ID - Jakarta. Kementerian Agama menyelenggarakan Sidang Isbat (penetapan) Awal…

admin 0 comments

Hepatitis Akut Misterius Serang Anak-anak di Eropa, Amerika dan Asia, Ini Gejala dan Imbauan WHO – Tribunnews.com

TRIBUNNEWS.COM - Kementerian Kesehatan (Kemenkes) telah meningkatkan kewaspadaan dalam dua pekan terakhir.Kebijakan ini menyusul pernyataan dari…

admin 0 comments

RI-Iran Sepakat Perkuat Dukungan Internasional dan Solidaritas Dunia Islam untuk Palestina – Tribunnews.com

Laporan Wartawan Tribunnews, Larasati Dyah UtamiTRIBUNNEWS.COM, TUNXI – Isu Palestina menjadi salah satu hal yang…

admin 0 comments

Kisah Mistis Taman Syariah Parepare yang Dulunya Kamar Mayat Rumah Sakit – detikcom

Taman yang diresmikan oleh Gubernur Sulsel Nurdin Abdullah pada tahun 2019 lalu ini berada di…

admin 0 comments

Wagub Jabar: Isi Kegiatan Ramadhan Bagi Generasi Milenial Untuk Perdalam Islam – Pemerintah Provinsi Jawa Barat

Tidak ada polling untuk saat ini.KABUPATEN TASIKMALAYA- Wakil Gubernur Jawa Barat Uu Ruzhanul Ulum mengapresiasi…

admin 0 comments

Kalender Kesehatan | Direktorat Promosi Kesehatan Kementerian Kesehatan Republik Indonesia – Direktorat Promosi Kesehatan dan Pemberdayaan Masyarakat

KONTAKFAQRSSSITEMAPKIEAKPMPSDPKTUInformasi lengkap kalender kesehatan direktorat promosi kesehatan dan pemberdayaan masyarakat tentang hari kesehatan dalam format…

admin 0 comments

Meski Kajian Islam Dibatalkan, Muslim Life Fair 2022 Tetap Ramai Pengunjung – Republika Online

Sunday, 21 Syawwal 1443 / 22 May 2022Sunday, 21 Syawwal 1443 / 22 May 2022Sabtu…

admin 0 comments

Kemenkes gencarkan 6 transformasi di tahun 2022 – Internasional Kontan

Reporter: Abdul Basith Bardan | Editor: Handoyo .KONTAN.CO.ID - JAKARTA. Kementerian Kesehatan (Kemenkes) menggencarkan 6 transformasi…